SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801501|ref|YP_326509.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801501|ref|YP_326509.1|
Domain Number 1 Region: 21-218
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.98e-34
Family LplA-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76801501|ref|YP_326509.1|
Sequence length 234
Comment lipoate-protein ligase [Natronomonas pharaonis DSM 2160]
Sequence
MHVVRGALDSADADRQVVQRLAESVASTGVPALRVWQPPKHVAFGRRDSAADGYEHARLA
ARERGYTPIQRRAGGTAVAYAPGTVAFAYAVSTATGRGGIEDRYRTATERLLAALASVGA
AVRRGEPSATFCPGTHSLRADGKVAGLAQRVKEETALVGGYVVGTDRASAAVADVLEPVY
RALGTPFDPTTVGSVEAAGGPASAGQVADAIEASFVDERPAKYRSAQELLDRSP
Download sequence
Identical sequences Q3ISE4
WP_011322576.1.57290 348780.NP1704A gi|76801501|ref|YP_326509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]