SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801546|ref|YP_326554.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801546|ref|YP_326554.1|
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.25e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000021
Further Details:      
 
Domain Number 2 Region: 281-405
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.98e-30
Family Anticodon-binding domain of Class II aaRS 0.00011
Further Details:      
 
Domain Number 3 Region: 409-482
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 7.65e-18
Family C-terminal domain of ProRS 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76801546|ref|YP_326554.1|
Sequence length 482
Comment prolyl-tRNA synthetase [Natronomonas pharaonis DSM 2160]
Sequence
MTDQELGITESKEHNPGEWYAEVVQKAGLADYAPMGGFIVTRPRGYALWERLQDHLDGWF
KETGVQNTYFPMFIPESYLEREKDIVDGFDPEVAWVTHGGHDELEERLAVRPTSESIITP
FIAEWVRSYRDLPLRVNQWCSVVRWEATETKPFFRTKEFLWQEGHTAHATEESAWDETMT
RLEQYERLYEEVMAIPGMTGRKPEHDKFPGADTTTTIEALMPDGKSVQAGTSHYLGTSFA
EAFDIEYTDEDETKQTAHTTSWGLSWRALGALIMTHSDDQGLVIPPALAPTQVVVVPIWQ
ADTEEAVKEYAADLAAELDEQFRVELDDRDERNPGFKFNEHELQGVPLRIEIGPNEVEDE
AATLVHRPDGESDVAERESITDAVDEALETVYAKLYASAEATLEENIRKAHGRGEILGTL
GQHGGYVKTGWCGDEACEAEIKDEIAAEIVMLPLDEDEPPVYDTCGVCGDEATETAYFAK
SY
Download sequence
Identical sequences Q3IS99
gi|76801546|ref|YP_326554.1| WP_011322621.1.57290 348780.NP1796A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]