SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801652|ref|YP_326660.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801652|ref|YP_326660.1|
Domain Number 1 Region: 5-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.98e-35
Family Nitrogenase iron protein-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76801652|ref|YP_326660.1|
Sequence length 206
Comment urease accessory protein [Natronomonas pharaonis DSM 2160]
Sequence
MGHRDVATVGLGGPVGSGKTAMVKRLVPRLDAAGYNVGVIANDIMTQEDADRLRESFEGI
LPPDLVEGVETGACPHTGIREDPSMNIAAIDEFTESYPDLDVVLLESGGDNLAATFNPEL
ADYFIFVISVAEGDDIPRKRGPGVTQADLLVVNKTDLAPHVDADLEVMRRDAETVRGDAP
TCFTDCKAEEGIDGVVDHIEEGVLFA
Download sequence
Identical sequences Q3IRZ3
348780.NP2014A WP_011322727.1.57290 gi|76801652|ref|YP_326660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]