SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801776|ref|YP_326784.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|76801776|ref|YP_326784.1|
Domain Number - Region: 25-71
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0178
Family CAP C-terminal domain-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76801776|ref|YP_326784.1|
Sequence length 94
Comment hypothetical protein NP2266A [Natronomonas pharaonis DSM 2160]
Sequence
MNTHAKSPSTTTPNRPSESPYRSHAAKRLAQYLRTELERADEALYVTGDRIADDVGLPPL
EVERLLRQLSDRVPGLSIRTDPSGSRTVWRVSRP
Download sequence
Identical sequences A0A1U7EVX1
gi|76801776|ref|YP_326784.1| WP_011322851.1.57290 348780.NP2266A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]