SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801848|ref|YP_326856.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801848|ref|YP_326856.1|
Domain Number 1 Region: 242-525
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.18e-88
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000132
Further Details:      
 
Domain Number 2 Region: 66-240
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.58e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000302
Further Details:      
 
Domain Number 3 Region: 530-633
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.62e-25
Family Anticodon-binding domain of Class II aaRS 0.00033
Further Details:      
 
Domain Number 4 Region: 4-63
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000000785
Family TGS domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801848|ref|YP_326856.1|
Sequence length 642
Comment threonyl-tRNA synthetase [Natronomonas pharaonis DSM 2160]
Sequence
MSEIVVTLPDGSELEMESGSTVEDVAYEIGPGLGDDTVAGVVDGELVDKAEQLTDDCELV
IVTDQSDEYLQVLRHSAAHVFAQALQRLHPEAKLAIGPPTEEGFYYDVTGVDLDADDLEA
IEAEMETIIEADHDIERAERSREEAFEIYEDNPYKRDILETEAADEDPVSFYTQDDWQDL
CQGPHVDSTGEIGAVELLNIAAAYWRGDEDNETLTRVYGTAFESESDLEGFLQRREEAKK
RDHRKLGQELDLFSIPDVTGPGLPLYHPNGKAVLRELEDFVDQLNDDQGYEFVETPHLFR
TELWKQSGHYENYVDDMFLLDVNDEEYGLKPMNCPGHATIFNQGNWSYRDLPVRYAENGK
VYRKEQRGELSGLSRVWAFTIDDGHLFVERDAIEQEVNVIMDQIEEVLDTFDLDYEVALA
TRPEKSVGSDEIWEQAQTQLRSVLESSGMDYDIESGDGAFYGPKIDFAFEDALGRNWDGP
TVQLDFNMPERFDLTYTGEDNEEHRPVMIHRALYGSYERFFMVLIEHFDGNFPTWLAPEQ
VRILPVSDDNIGYAKQLKNRYLDDFRVEIEDRSWTVGKKIQTAHDDRVPYMLVVGDNEEE
AGTVSVRDRFEDERKDVDVETFRDHLASEVEEKRVEPDFVDE
Download sequence
Identical sequences Q3IRE7
gi|76801848|ref|YP_326856.1| 348780.NP2410A WP_011322922.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]