SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801902|ref|YP_326910.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801902|ref|YP_326910.1|
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000091
Family PF1790-like 0.05
Further Details:      
 
Domain Number 2 Region: 125-266
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000502
Family TrmB middle domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801902|ref|YP_326910.1|
Sequence length 268
Comment hypothetical protein NP2518A [Natronomonas pharaonis DSM 2160]
Sequence
MASLRDLGLSEYEARAYRALLKTGPTTAKELSRVSDVPMGRIYDVLNSIEQYNLVRSQSA
SRPKKYVAVEPSTALDRLLEDKKRELDEKANQYESIVDELSGELETAEPVEDTFWTAAVG
PDETVDLLMERISAADSEVVMVLSSYIEQFFDIDTVGTLILDELTDAMDRGVDVRLLMRP
EVMSVLPESIGERYRTSLTENERFTVCISEDVTGTFTLIDDNEVTIEVPHPLKNREVFAM
IDLKDREFAQSVRSEFEPRWEQAEELTF
Download sequence
Identical sequences A0A1U7EW79
WP_011322976.1.57290 gi|76801902|ref|YP_326910.1| 348780.NP2518A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]