SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801921|ref|YP_326929.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801921|ref|YP_326929.1|
Domain Number 1 Region: 13-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000675
Family PF1790-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76801921|ref|YP_326929.1|
Sequence length 123
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MPIVHTSVEGEQTIEDILDTIGDQHARDVLAAISREPRSAKELADECDLSLPTIYRRLEV
LESNDLVVERTAVSGDGNHYNIYECNFDSTVIQLEDDEYKVRIYRRENLPDRFTQLWDDL
GKD
Download sequence
Identical sequences A0A1U7EWB0
348780.NP2558A gi|76801921|ref|YP_326929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]