SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801951|ref|YP_326959.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801951|ref|YP_326959.1|
Domain Number 1 Region: 66-249
Classification Level Classification E-value
Superfamily GAF domain-like 2.94e-39
Family IclR ligand-binding domain-like 0.00049
Further Details:      
 
Domain Number 2 Region: 11-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000159
Family Transcriptional regulator IclR, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801951|ref|YP_326959.1|
Sequence length 252
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MDDDSTDDVGVTTTRKTFEILEVLRDEEGLSIAEITRRTSLTKSTVYRHLKTLVDTGYAI
EREGAYYIGLKHLEIAEQARNREPGYTIAQRKVFELGRETDERSVFLVEEEDEGVYLHRY
DSPTSTMVGQRRPLHALATGKAILAERDGEQIDRFVAENDLERYTENTITTPEALLEEVE
SVREQGYATNDGEYMEGLFGVAVPVYTPDDDLLGSLGLFGPRSRFSEEYIQETVLDRLWD
KAGEVRVTLAYG
Download sequence
Identical sequences A0A1U7EWD7
348780.NP2618A WP_011323025.1.57290 gi|76801951|ref|YP_326959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]