SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802048|ref|YP_327056.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802048|ref|YP_327056.1|
Domain Number 1 Region: 9-105
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.28e-30
Family HxlR-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802048|ref|YP_327056.1|
Sequence length 108
Comment hypothetical protein NP2812A [Natronomonas pharaonis DSM 2160]
Sequence
MSNTQRRLEAACPVVESMDQIGSKWRLLVLHDLQHGEKRFNELKRSTGANSRTLSRVLDD
LQETEFVERRLEEDAPVATYYSLTQKGRSLAPVFDEIEEWADEWLEIE
Download sequence
Identical sequences A0A1U7EWN2
gi|76802048|ref|YP_327056.1| 348780.NP2812A WP_011323122.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]