SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802142|ref|YP_327150.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802142|ref|YP_327150.1|
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.4e-20
Family F93-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76802142|ref|YP_327150.1|
Sequence length 92
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MYDLTGFQRDLLYVIAGREEPHGLAIKEELEDYYEKEIHHGRLYPNLDTLVEKGLVEKGQ
RDRRTNFYTLTRRGRREIEARRDWEDEYVDIE
Download sequence
Identical sequences A0A1U7EWU9
348780.NP3002A WP_011323216.1.57290 gi|76802142|ref|YP_327150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]