SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802163|ref|YP_327171.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802163|ref|YP_327171.1|
Domain Number 1 Region: 122-242
Classification Level Classification E-value
Superfamily MOP-like 2.61e-18
Family BiMOP, duplicated molybdate-binding domain 0.037
Further Details:      
 
Domain Number 2 Region: 30-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000197
Family N-terminal domain of molybdate-dependent transcriptional regulator ModE 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76802163|ref|YP_327171.1|
Sequence length 245
Comment ABC-type transport system operon protein [Natronomonas pharaonis DSM 2160]
Sequence
MTGEHSTAPRGYPPLMNRTNGQGEAALVAEGVEFDADDATLLREINETGSVARASSNLGR
SRARQLSRIETLESAFGDLVERRRGGSGGGGSRLTENAGALLRRYDRLQTALTATDTVPE
TVLNGTVTAVLGELADVETEIGTVRGLHPDVTAGDDVQVRIGADAVTLQDPADSPGPDAT
SARNRYQGTVTAVEHGETVLEVTVAVSDVPFRALVTDESADRLGLDAGCPVVLTWKATAT
RLALR
Download sequence
Identical sequences gi|76802163|ref|YP_327171.1| 348780.NP3046A WP_011323236.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]