SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802172|ref|YP_327180.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|76802172|ref|YP_327180.1|
Domain Number - Region: 14-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0017
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.01
Further Details:      
 
Domain Number - Region: 188-245
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0117
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802172|ref|YP_327180.1|
Sequence length 347
Comment nirG protein homolog / nirH protein [Natronomonas pharaonis DSM 2160]
Sequence
MSTPATDDDWRAGIDDIDAALIDGYQSGFPVTERPFRTVADDLGITESEALTRVEDLYEQ
GIFRRFGAVLNPPVIGASTLAAVSAPDDRFEEVAETINGYRQVNHNYRRDHEWNMWFVVT
AGSLETRNAILEEIAAETGCEVLNLPMLTDFYIDLEFPVVNGDRFARESVSETTADATRI
SETAAADLSPLDEAILLEIQDGLPLTETPYRDVAAAVDAPVASVCESIEALRADGCIKRI
GCVVNHIVTGFDANCMVVWDVPDEDLDTRGEAVGELPYVTLCYNRPRRPDQDWPYNLFTM
IHGRDPDAVDEKIDELADEALPYDHERLYSTETLKQTGARYDEILGS
Download sequence
Identical sequences A0A1U7EWX9
gi|76802172|ref|YP_327180.1| WP_011323245.1.57290 348780.NP3064A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]