SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802252|ref|YP_327260.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802252|ref|YP_327260.1|
Domain Number 1 Region: 233-626
Classification Level Classification E-value
Superfamily DHH phosphoesterases 1.7e-43
Family Exonuclease RecJ 0.022
Further Details:      
 
Domain Number 2 Region: 25-83
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000296
Family Cold shock DNA-binding domain-like 0.0093
Further Details:      
 
Weak hits

Sequence:  gi|76802252|ref|YP_327260.1|
Domain Number - Region: 122-191
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000146
Family Anticodon-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76802252|ref|YP_327260.1|
Sequence length 635
Comment hypothetical protein NP3224A [Natronomonas pharaonis DSM 2160]
Sequence
MTHSAAGDAGGNRSAEVVYELAPGCTLEDIEAGAAYLATVNGVVDYGVFVDLSEHVSGLV
HESNLQNDHDVGDELVVELVEERENGDLGFEELDADPDEVDRTSVNEGTAARTGDLADHV
GETVHLEGDIVQIKQTAGPTIFSLRDGDGVVPCAAFESAGVRAYPAVELDDTVRITGAVE
THEGALQLEVDKLVRLRGEAADEVRTELDADLEARAAPADVEPLIEWPAFEKLHDDLADL
ARRLRRAVLESRPIRLRHHADGDGMCASLPVQIALERFIDEVHHDPDAGRHLLKRLPSKA
PFYEMEDVTRDLNFALEDRERHGQRLPLLFMVDNGSTEEDTPAYRAVSEYDIPVLVVDHH
HPDPDAVGPLVEQHVNPYLHDEDYRITTGMMCVELARMIDPSLTEELEHVPAVAGLSDRS
KADAMDQYLELAADAGYDESDLQDIGEALDYAAHWLRYQSGRNLIKDILNLDCDDAARHR
ELVSFLADRAERDVAEQIDDAEPHVEHERLDNGAHLYRLDVENHARRFTYPAPGKTTGEL
HDRKVTETGDPVITIGYGPDFAVLRSDGVRLDIPNMVTELKSEVDGAGVSGGGHLVVGSI
KFVPGMREPVIDALVEKMADAELDEDLRSTLVRDD
Download sequence
Identical sequences A0A1U7EX53
348780.NP3224A gi|76802252|ref|YP_327260.1| WP_011323325.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]