SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802268|ref|YP_327276.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802268|ref|YP_327276.1|
Domain Number 1 Region: 2-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-37
Family Extended AAA-ATPase domain 0.0033
Further Details:      
 
Domain Number 2 Region: 264-330
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000061
Family Penicillinase repressor 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76802268|ref|YP_327276.1|
Sequence length 334
Comment cell division control protein cdc6-like protein [Natronomonas pharaonis DSM 2160]
Sequence
MIVDARALDVEAVPSEILRRNNELNALSNALEPLLDGYRGEHSIVVGPSGAGKTACARYT
VEQLRRSLVDVRAQYINCWQHSSRFAALLQLVDGIGQSMDIQQHSTPHDELLRRLRNVDD
RPYIVILDEADQLDCREDILYELTTLDHVYMILICNRERELLDGLDRRVVSRLRGCRRIE
FEAYSTATLVDILDRRAEVGLEAGSLTDGVLREIAEVSNGDARVAIRTLAEAAKQAERDS
TSIKSDYVDEAVSEAEENIRQKAISQLNRHQRVIYDVLEEDGGWLPMGELYPEYSERVDE
ARTKTTVSNYLSKIAEYNLVELKGEKRGRRYRAI
Download sequence
Identical sequences A0A1U7EX59
WP_011323341.1.57290 348780.NP3258A gi|76802268|ref|YP_327276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]