SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802343|ref|YP_327351.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802343|ref|YP_327351.1|
Domain Number 1 Region: 4-180,332-384,465-557
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000017
Family ABC transporter ATPase domain-like 0.062
Further Details:      
 
Domain Number 2 Region: 309-462
Classification Level Classification E-value
Superfamily Tropomyosin 0.000018
Family Tropomyosin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76802343|ref|YP_327351.1|
Sequence length 591
Comment rad50 ATPase [Natronomonas pharaonis DSM 2160]
Sequence
MTWKLEIENIAGIRSGAATIEPGLNVVHAENWQGKSSFLKSIRTVFGTANPITESCDEGY
VELREEETTTTVRLTRADGRIIREGDPVLETPYDRRRAILFAFLGEENEIRRAVRRGEDL
EDELTAPLDLQNIDEQITALTEKREDIERQLEQAERAADDAIDLEQRVQELSAELEELRS
ERSSMETHGDSDSGSTTQALADKQAQLERQRNRKSRLESTVQRVEDRLTELDAAESGIDV
PEAAVGEELATVETELRRLNSDIDLLQSLYSANHRLLEEDRLELVADIDRSIAGDVVSCW
VCGADSDRETIESYVTALGERLSDARAERDELQQRHEELKSRREQRQEAEKRLQEIRDQQ
SELERQLEEKRESLADVEERIEELEDKVEALESEAEAASEQRTDIESEIKFTETKLEETK
ASLEEKRDTADRRPELEARRDELTAEITDLRTEKKTTKRRLRTEFEDAVDDVIERFETGF
EKARLTDSFNLVVARDGREASLDALSEGERELLGLLVALAGHEAFEVGEDVPVLLFDGLG
ALSAANLEKLADYVEGRAERIVFTAYPEHSTEGAHEIDPADWKVVSGRDEA
Download sequence
Identical sequences Q3IQ02
348780.NP3410A gi|76802343|ref|YP_327351.1| WP_011323416.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]