SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802353|ref|YP_327361.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802353|ref|YP_327361.1|
Domain Number 1 Region: 5-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.46e-51
Family ABC transporter ATPase domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76802353|ref|YP_327361.1|
Sequence length 252
Comment branched chain amino acid ABC transporter ATP-binding protein [Natronomonas pharaonis DSM 2160]
Sequence
MSSTPILETVDVRKEFGNLVAVDGISLEFYTDETVGIIGPNGAGKTTFINLISGVLPLTD
GQILFAGDDISDLKRYKRVRRGLVRSFQIPQIYDELTLRENIQSSILSRKQENNRLFTPT
DREEESLQEANELIETFNLEAHADEHTEHLPHGVRKVLDVAMSFALEPQIMFLDEPTSGV
GSKEKNDVMETITQAADEQNIGLVFIEHDMELIREYSSRTVALHEGRVLLDDEPDAVFNS
EEVNEFILEGGV
Download sequence
Identical sequences A0A1U7EXA6
WP_011323426.1.57290 348780.NP3430A gi|76802353|ref|YP_327361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]