SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802358|ref|YP_327366.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802358|ref|YP_327366.1|
Domain Number 1 Region: 23-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000291
Family Cold shock DNA-binding domain-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76802358|ref|YP_327366.1|
Sequence length 121
Comment hypothetical protein NP3440A [Natronomonas pharaonis DSM 2160]
Sequence
MNYDEFLDALAAGDERYLESPEGHGWLPPRRVCPESGSTDLSPAALPEEGEIVALTQVHV
PAPDFADDAPYCTAVVDFGPVRVTGVLQGVEYEAVAIGDTVTAGVGHSETTDERIVVFEP
V
Download sequence
Identical sequences A0A1U7EXB5
348780.NP3440A WP_011323431.1.57290 gi|76802358|ref|YP_327366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]