SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802360|ref|YP_327368.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|76802360|ref|YP_327368.1|
Domain Number - Region: 106-159,276-386
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00038
Family Shikimate kinase (AroK) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76802360|ref|YP_327368.1|
Sequence length 686
Comment serine protein kinase 1 [Natronomonas pharaonis DSM 2160]
Sequence
METLEELSKEYRDTIPSDLRRVHSFEWYLETLYEDPKVARSSHQRLADMFDYYGTEYDEE
AGVVEYALAAEDPLDEGENTFYGRGIHESIHEFVNKVKSGARGLGPEKRIKLLLGPVGSG
KSDFDRQVRQYFEDYTARDEGRMYTFRWTGLCDILGDQDPSDDVVRSPMNQDPLVLLPPK
QRERVLEDINEALDAPYTIRNEQALDPASEFYMDALLEHYDDDLQQVLENHIEVVRLLAD
ENKRQAIETFEPKDKKNQDETELTGDVNYSKIAVYGESDPRAFDYSGAFCNANRGIFSGE
ELLKLQREFLYDFLHATQEQTIKPKSNPRIDIDQVIVGRTNMPEYRDKKGDEKMEAFNDR
TKRIDFPYVLQYDAEARIYRKMLKNADVPEMHVEPHTLEMAGLFGVLTRIEEPDGGTISI
LQKAKAYNGEIDEGEDIDVTKLREEGDTTADIGEGMDGVSPRFIGDEIAEAIMDSMHRGR
TFLSPLAAFNHLEENLENHGSIPEEQFEDYYRYLELVREEYKERAIEDVRHALAYDLDEI
QRQGEKYMDHVMAYIDDDTVEDELTGREQDPDEAFLRAVEEKLDVPGDRKDDFRQEVANW
VSRRAREGEPFEPQDNDRLRRALERKLWEDKKHNINFSALVSSGDLDDDERNAWVDALEE
QGYSTDGAKEVLEFAGAEVAKSELEE
Download sequence
Identical sequences A0A1U7EXC2
348780.NP3444A gi|76802360|ref|YP_327368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]