SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802375|ref|YP_327383.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802375|ref|YP_327383.1|
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 3.01e-55
Family ATP-dependent DNA ligase DNA-binding domain 0.00047
Further Details:      
 
Domain Number 2 Region: 225-422
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.77e-51
Family ATP-dependent DNA ligase catalytic domain 0.00016
Further Details:      
 
Domain Number 3 Region: 425-546
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-35
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802375|ref|YP_327383.1|
Sequence length 548
Comment DNA ligase (ATP) [Natronomonas pharaonis DSM 2160]
Sequence
MEFAEFAARAAEIESEPADLETVDLVATLCADAGDDLGTVARFVQGRVFPAHDSTKLDIG
PSLCYEALAKAAGPNVDSDDIERRLAEVGEIGAVAESLDLGGQQGLAAFGGGTDREALTV
SGVEETLQALAAAAGDGSTDAKRDRLFDLFNRAEPTEARFLARLVLGEMRVGVGEGTVRD
AIAAAFEVPEPDVERALQVANDCGLVAETARDDGAAGLDDIGLVVGRPVKAMLAQAGTAV
EALDEWGTAAVETKYDGARVQVHYDGDSARLFSRNLEEVTEPLPEVVEFVEQSLSVPAIL
DGEVVAVDDDGTPRPFQEILRRFRRKHDVAAAREDVSVELYAFDCLHVDGEDLLDTPLSE
RHDRLESLLADGVSPLSYADDADEVADIEADALDAGHEGIMLKNPDSTYTPGSRGKNWLK
RKPDVETLDLVVTGAEWGEGRRANLLGTFVVSARADDGYEPVGKVATGITDEELERLHER
LQPHVRTEDGTDVDIEPAVVFEVGYEEIQQSPTYGSGYALRFPRFVGVREDKSPSDADSL
ERIDRLTS
Download sequence
Identical sequences Q3IPX0
gi|76802375|ref|YP_327383.1| WP_011323448.1.57290 348780.NP3474A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]