SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802442|ref|YP_327450.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802442|ref|YP_327450.1|
Domain Number 1 Region: 71-253
Classification Level Classification E-value
Superfamily GAF domain-like 1.05e-41
Family IclR ligand-binding domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 15-85
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000011
Family Transcriptional regulator IclR, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802442|ref|YP_327450.1|
Sequence length 259
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MTRQRVHISMSDDRVQATATSVRILEGIVELDGEAGVTELSTHLSLAKSTVYKHLNTLQT
TGVVVQRGDRYRIGLKTLEFGGYAQRHDGIYETARPEIESMARKSGELANLMFEEGGRGV
YVHTARGDDAVDLDTQTGRRVHLHATGLGKAILATLDDERVRTIIDRHGLPEVTPHTITD
EEALFEELAAIRSAGVAYDREECVPGMACIARPLSTPGPRPAAISITGPVSRITADETES
EARQLVEQTGNVIELNLTE
Download sequence
Identical sequences gi|76802442|ref|YP_327450.1| 348780.NP3608A WP_011323515.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]