SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802571|ref|YP_327579.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802571|ref|YP_327579.1|
Domain Number 1 Region: 328-410,479-657
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.43e-41
Family Tandem AAA-ATPase domain 0.002
Further Details:      
 
Domain Number 2 Region: 90-296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.33e-30
Family Tandem AAA-ATPase domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802571|ref|YP_327579.1|
Sequence length 958
Comment ATP-dependent helicase [Natronomonas pharaonis DSM 2160]
Sequence
MSSQLPSNIQPGSVVENRNRLWRVDAVDGNVVTATPLDGNTADRHRFYTPVENIEEGSLE
PPDPKKLGNPEFQRLLNRAYRLSMLHGTAPLVSLQRSRVIPTEYQLTPVVMALDMPRVRM
LLADDVGLGKTIEAGLITSELMARNKADRILIITPANLREQWREAFNYFFHIDADIISRR
HRKAMEKEIPPGTSPWEHFSKLIVSIDYAKQNSVRHEILDQDWDLVIIDEAHQAAKPHES
GANETVDMQRWDFATEITDHAEHCLLLTATPHNGYTDSFASLIRMLDVDAVSGPRHDPTI
HRDIAQRHVVQRRRDDVKQWFSDSDGQSPFPERDQDEVRVTPTEYEQETYDAVREYGELL
MSSAQRSSSKSQTLARWSVIHFLKRALSSPEALRQSLKNRQDKLEDRLEDLDEEDTQTVI
EETAGISESMAQANALDDDPGEEYSEEEVGERVERVVTGDKAAIERELDVLENVAEKAER
VTKTRDAKLQRLLDETLPNRFQYPRVIIFTKYVDTLEYLEEQIKDSQSDETEVFTLHGSL
NEAQRKERFKEFEDSTRGVLIATDVISEGMNLQHAANQIIHYELPWNPNRLEQRNGRIDR
YGQKNDEVVIRTMVVEDQMDVAILEKLVQKANNIRQEYGFSPPYFGDDEGILELLKDEGI
DAGVPQATLEEFGGGSAPAERESASVFDDQTLDRIKSESFYGHTEVGLQEVQKRQEETHQ
RIGGQGTLEQFVKSALDLFSCSYEMNVQGHLDIKITADRLQGPDIKREYEDVTFDPNEAS
QSSDTEMLDIAHPLVQRLIEAVKETALTDEDRYGRTAIRGTNEVSEPTAVYTALVRYVAD
TKPDPTIMEELVQVGLPIYGDEPLEQDIVEALEESEAKPVQRTSMEKEDDLKDALGHGAF
EQTLQRRAEQRRDKIVEQRTEMRAELEKSGSGSWLSGIDDVEIASKDLLTVTVYYGSN
Download sequence
Identical sequences A0A1U7EXV3
WP_011323644.1.57290 gi|76802571|ref|YP_327579.1| 348780.NP3872A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]