SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802603|ref|YP_327611.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802603|ref|YP_327611.1|
Domain Number 1 Region: 67-164
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000284
Family MarR-like transcriptional regulators 0.081
Further Details:      
 
Weak hits

Sequence:  gi|76802603|ref|YP_327611.1|
Domain Number - Region: 2-61
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000196
Family MarR-like transcriptional regulators 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76802603|ref|YP_327611.1|
Sequence length 169
Comment hypothetical protein NP3936A [Natronomonas pharaonis DSM 2160]
Sequence
MSDTRARVKSHVESNPGVHFNAISRELDIATGQTQYHIRKLLRENRLTSMELCGRTHYFP
LGYSEHEQAGFALLRRETTRELVVLLLDEGPMAPDDLATEADIARSTVEWHLSNLVDCEL
AEKQYEGRSVRVHVTEPELLRELLVEIDPTLPDRLVDRFSRLVDSLLEP
Download sequence
Identical sequences A0A1U7EXX5
WP_011323676.1.57290 gi|76802603|ref|YP_327611.1| 348780.NP3936A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]