SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802687|ref|YP_330782.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802687|ref|YP_330782.1|
Domain Number 1 Region: 7-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.16e-22
Family Transcription factor E/IIe-alpha, N-terminal domain 0.002
Further Details:      
 
Weak hits

Sequence:  gi|76802687|ref|YP_330782.1|
Domain Number - Region: 116-147
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.000732
Family RBP12 subunit of RNA polymerase II 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76802687|ref|YP_330782.1|
Sequence length 175
Comment hypothetical protein NP4106A [Natronomonas pharaonis DSM 2160]
Sequence
MAFEDLLNDPVIQKYLHELVGPTGMPVAAAPPDGEVTDEELAEELGLELNDVRRALFILY
ENDLASYRRLRDEDSGWLTYLWTFQYENIPEQLEEEMHRLLEALENRRQYESENEFYLCG
ECQLRFEFDEAMEFGFECPECGGRLESMENDRLVNAMEQHIEALRDELHVETAEA
Download sequence
Identical sequences Q3IP08
gi|76802687|ref|YP_330782.1| 348780.NP4106A WP_011323760.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]