SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802763|ref|YP_330858.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802763|ref|YP_330858.1|
Domain Number 1 Region: 65-248
Classification Level Classification E-value
Superfamily GAF domain-like 1.83e-32
Family IclR ligand-binding domain-like 0.00095
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000018
Family Transcriptional regulator IclR, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76802763|ref|YP_330858.1|
Sequence length 259
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MIPDTSSREVKSVRTAFRIIDILRDYDGVDIDELADRLGLAKSTVHNYLSTLRGMGYVVE
RDGSYRLGLRFLTEGMAAQSSLRLRPAVAEVIGSVAETVGQPTWWVVEEHGRGIFVESAI
PPGTRRIYGRVGKRSYLHTHAPGKAILAALSDEYIEDIVDFHGLPGHTERTHTDLDSLRE
DIETARKRGFAVADGEAALGVRSVGVAFEGPSGYTHGLGVFGYSHDFGIPPESDITAALS
AAADELAAAGQNDTTEGGA
Download sequence
Identical sequences A0A1U7EYC0
gi|76802763|ref|YP_330858.1| WP_011323836.1.57290 348780.NP4258A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]