SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802895|ref|YP_330990.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802895|ref|YP_330990.1|
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-32
Family GHMP Kinase, N-terminal domain 0.0000695
Further Details:      
 
Domain Number 2 Region: 155-273
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.58e-24
Family Homoserine kinase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802895|ref|YP_330990.1|
Sequence length 291
Comment homoserine kinase [Natronomonas pharaonis DSM 2160]
Sequence
MITVRAPATSANLGSGFDVFGAALERPADILRIEKANRTTIRVTGVGSKYIPEDPEKNTV
GAVAEALDAPAHIEIDKGVRPASGLGSSAASAAAAAVGLNELYDRGLSREELVPIAAEGE
AVVSGAAHADNVAPSIMGGFTVAREDGVTQVDASIPLVACLPEIVVSTRDARGVVPEAAP
MEAVVDVVGNAATLAVGMARDDPALVGRGMEDSIVTPERAELINGYETVRSAAENAGATG
VTISGAGPTVIAACHRGDRTAIASAMLDAFSEAGVEARAYKTEIGRGAELF
Download sequence
Identical sequences Q3INF0
gi|76802895|ref|YP_330990.1| 348780.NP4524A WP_011323968.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]