SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802940|ref|YP_331035.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|76802940|ref|YP_331035.1|
Domain Number - Region: 17-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000146
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.07
Further Details:      
 
Domain Number - Region: 82-126
Classification Level Classification E-value
Superfamily TM1646-like 0.0445
Family TM1646-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802940|ref|YP_331035.1|
Sequence length 179
Comment hypothetical protein NP4614A [Natronomonas pharaonis DSM 2160]
Sequence
MGDASHGPWTNTMSGRERVREVVETLNEATAVQEIADQAAVSRATADDELQRLEDDDWVI
ETTIDGTKAYDANPVRMLFDEVTTLIEEHTRDELEEQLTDLKEEQEALASEFNASSLDEF
REQLAEEELSASELRERRNVIATWEAVNTELALVKHALYLYGDVVELTSPKSNSFSSFA
Download sequence
Identical sequences A0A1U7EYU0
348780.NP4614A gi|76802940|ref|YP_331035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]