SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802974|ref|YP_331069.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802974|ref|YP_331069.1|
Domain Number 1 Region: 55-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000294
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76802974|ref|YP_331069.1|
Sequence length 142
Comment hypothetical protein NP4684A [Natronomonas pharaonis DSM 2160]
Sequence
MTENTLKITFQQAREHRQAARERLRQAEAGDTSKPIEQDVRFILNFEEFDDIARLMRTAN
LELIEAIVSEEPASIRQLAETVDRDYREVHRNLTELESLGVIEFEDDGSRKKPLLRDGAE
NIDFSIRFPRSPDRGEVPGTSA
Download sequence
Identical sequences A0A1U7EYU2
348780.NP4684A gi|76802974|ref|YP_331069.1| WP_011324047.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]