SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802994|ref|YP_331089.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802994|ref|YP_331089.1|
Domain Number 1 Region: 65-124
Classification Level Classification E-value
Superfamily Iron-dependent repressor protein, dimerization domain 1.06e-17
Family Iron-dependent repressor protein, dimerization domain 0.0012
Further Details:      
 
Domain Number 2 Region: 4-63
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000538
Family Iron-dependent repressor protein 0.015
Further Details:      
 
Domain Number 3 Region: 147-215
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.0000014
Family FeoA-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76802994|ref|YP_331089.1|
Sequence length 223
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MDASPVVEEYVKQLHRLEAEHGRRIRTTELAEAVDRTKASTTSMVQKLDERGLVEHEEYG
GTALTPTGEAVADRLVRKHRLLETFLVEQLDLPEAVAHDEADRLEHHVSDGVTDRLAELL
GAPGGPAWDSRAVYPAAASAKRLTSGEPGESLVVEAVPHRQPKARSYLLERGVKPGAVIE
VDEVGPAGLVTVTDAAGDRSVPVPGRLARYVGVRPPPGVDRND
Download sequence
Identical sequences A0A1U7EYY7
WP_011324067.1.57290 348780.NP4726A gi|76802994|ref|YP_331089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]