SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803007|ref|YP_331102.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803007|ref|YP_331102.1|
Domain Number 1 Region: 5-69
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.71e-19
Family eIF5a N-terminal domain-like 0.00071
Further Details:      
 
Domain Number 2 Region: 70-123
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000214
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76803007|ref|YP_331102.1|
Sequence length 124
Comment translation initiation factor IF-5A [Natronomonas pharaonis DSM 2160]
Sequence
MPKEQKEVRDLQEGNYVMIEDVPSKITSYSTSKPGKHGSAKARVEGTGVFDGQKRNFTQP
VDAKVWVPIVNRKQGQVVSVSGDDMQVMDLETYETITMRIPEDLAPESDDEIEYLEFEGQ
RKVV
Download sequence
Identical sequences Q3IN38
348780.NP4752A WP_011324080.1.57290 gi|76803007|ref|YP_331102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]