SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803044|ref|YP_331139.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803044|ref|YP_331139.1|
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000627
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 58-133
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.0000000000563
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76803044|ref|YP_331139.1|
Sequence length 137
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MDDLDREILAILRRDSRTPYTEIAEQVGTSEGTVRNRVERLLEEGIIERFTIATRTGNVK
AMIEISVAVDVDTGDIADRMTEWREVDFVWQVSGEEDVVVVVDTTDTGTLNDLITRAREL
DEVVSTKTRLILAERRG
Download sequence
Identical sequences A0A1U7EZ18
348780.NP4828A WP_011324117.1.57290 gi|76803044|ref|YP_331139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]