SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803066|ref|YP_331161.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803066|ref|YP_331161.1|
Domain Number 1 Region: 33-111
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.83e-22
Family Cold shock DNA-binding domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76803066|ref|YP_331161.1|
Sequence length 114
Comment 30S ribosomal protein S17P [Natronomonas pharaonis DSM 2160]
Sequence
MAIGLDVTQPPEPENPEEYDYETCPFYGELPVRGQVIEGTVVSTDMERTVIVEREYDVNV
PKYDRLMKRRSRIPAHVPEVLEPLSVDDEVKIAETRPLSKTKSHVVVEVTEGDA
Download sequence
Identical sequences A0A1U7EZ28
WP_011324139.1.57290 gi|76803066|ref|YP_331161.1| 348780.NP4872A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]