SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803077|ref|YP_331172.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803077|ref|YP_331172.1|
Domain Number 1 Region: 40-111
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 7.32e-20
Family Ribosomal S5 protein, N-terminal domain 0.00083
Further Details:      
 
Domain Number 2 Region: 125-203
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-19
Family Translational machinery components 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76803077|ref|YP_331172.1|
Sequence length 211
Comment 30S ribosomal protein S5P [Natronomonas pharaonis DSM 2160]
Sequence
MSNGWEPRTRLGRKVADGEITSMQDALQSGLPLKEPELVDQLLPGLEDEVLDINMVQRMT
DSGRRVKFRCVVVIGNRDGYVGYAQGRDDQVGGAIQKAIDVAKLNIIDVPLGSGSWEDRP
GGRNSLMRRTTGKAGSVEVELKPAPRGLGLAAAPTVRHVLELAGVEDAWTKCHGNTRTTL
NLAKATYNALRNASESRTPEHTRQVRQEAQE
Download sequence
Identical sequences Q3IMW8
gi|76803077|ref|YP_331172.1| WP_011324150.1.57290 348780.NP4894A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]