SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803118|ref|YP_331213.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|76803118|ref|YP_331213.1|
Domain Number - Region: 21-49
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0236
Family GHMP Kinase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76803118|ref|YP_331213.1|
Sequence length 62
Comment hypothetical protein NP4978A [Natronomonas pharaonis DSM 2160]
Sequence
MPDTPTRYDGLLAAMPASMAGGAAAGWWSTAPLAAGLGLGSAVAAAFVAVSLFVVPPVPS
RG
Download sequence
Identical sequences A0A1U7EZ70
gi|76803118|ref|YP_331213.1| 348780.NP4978A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]