SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803122|ref|YP_331217.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803122|ref|YP_331217.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily PIN domain-like 0.0000000533
Family PIN domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|76803122|ref|YP_331217.1|
Domain Number - Region: 121-146
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.0262
Family RpoE2-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76803122|ref|YP_331217.1|
Sequence length 151
Comment hypothetical protein NP4986A [Natronomonas pharaonis DSM 2160]
Sequence
MHVLDSSAFINDYTTDEQLATIPLVREELESEAGYRFDALEGSGMRIHIPDPETVERVKR
AARETGDAETLSRTDIRLLATAFELDGVLVTDDYAMQNVADKLDTAVEVIAQEGIDERRD
WNYQCQGCGRTFDEHHERCQICGSDLERKRP
Download sequence
Identical sequences A0A1U7EZ65
gi|76803122|ref|YP_331217.1| 348780.NP4986A WP_011324195.1.57290 NpR24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]