SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803147|ref|YP_331242.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803147|ref|YP_331242.1|
Domain Number 1 Region: 146-396
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.73e-69
Family Extended AAA-ATPase domain 0.00000121
Further Details:      
 
Weak hits

Sequence:  gi|76803147|ref|YP_331242.1|
Domain Number - Region: 22-72
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0759
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76803147|ref|YP_331242.1|
Sequence length 405
Comment proteasome-activating nucleotidase [Natronomonas pharaonis DSM 2160]
Sequence
MSHSPSLPDRPTLNLDPEMSEAERLAALRNHFIEVSQVHEELADQLEDARERQSELHEEV
SELQAENEALKTSSLYLATVEELTDDQVLLKQHGNNQEVITDVSPRLYNQLEAGDRVAIN
DSFAIQTVLDAETDARAQAMEISERPDVGYADIGGLDEQIREVREAVEDPLTNPGKFEEV
GIEPPTGVLLHGPPGTGKTMLAKAVANQTDATFIKMAGSELVQKFIGEGARLVRDLFELA
AEREPAIIFIDEIDAIAAKRTESKTSGDAEVQRTMMQLLSEMDGFDRRGDISIIAATNRF
DMLDRAILRPGRFDRLIEVPEPDIEGRTQILQIHSRGMQLDSAIDLAAIAEETEGFSGAE
LESLTTEAGMFAIRDGRTEVRREDFDDALEKIAEDDAAGTPIAFY
Download sequence
Identical sequences A0A1U7EZA6
WP_011324220.1.57290 NpR91 348780.NP5038A gi|76803147|ref|YP_331242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]