SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803150|ref|YP_331245.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803150|ref|YP_331245.1|
Domain Number 1 Region: 1-324
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.36e-69
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000336
Further Details:      
 
Domain Number 2 Region: 336-419
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 9e-19
Family Anticodon-binding domain of Class II aaRS 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76803150|ref|YP_331245.1|
Sequence length 432
Comment histidyl-tRNA synthetase [Natronomonas pharaonis DSM 2160]
Sequence
MYDGLKGFREFYPGEMSARREVTDTIETRARRYGFREVGTPALERTQLYVDKSGEEIVEE
LYAFEDKGGREVSLTPELTPTVARMVVAKQQALAKPVKWFSTRPFWRYEQVQQGRFREFY
QTNIDIFGSERPEADAEVLATAADALTDLGLDGADFEFRVSHRDILGGLLAAMDSDVDTT
DAIRAVDKREKIDDEEYRSLLVGAGLTHEEADTFDSLLRTDDLSELVEFAGTDRVEAAVE
NLQAVLDAAADFGVREFCSVSLETARGLDYYTGVVFECFDTSGEVSRSVFGGGRYDDLIE
SFGGQPTPAVGVGIGHETLSLLCQRAGVWPAEELSTDYYVLTVGDTRDVALDVARELRAL
GHVVETDLSDRGFGDQLSYADGINAETVVVVGEQDLEDDAVTLKDMASGDQTQVPLAAFP
PEEGRPTYDDYA
Download sequence
Identical sequences Q3IMP5
WP_011324223.1.57290 348780.NP5044A gi|76803150|ref|YP_331245.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]