SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803181|ref|YP_331276.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803181|ref|YP_331276.1|
Domain Number 1 Region: 14-242
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.59e-57
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0000322
Further Details:      
 
Domain Number 2 Region: 331-473,604-670
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.88e-35
Family Intein (protein splicing domain) 0.019
Further Details:      
 
Domain Number 3 Region: 285-354,673-960
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.76e-32
Family Extended AAA-ATPase domain 0.024
Further Details:      
 
Domain Number 4 Region: 489-547
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000591
Family SinR domain-like 0.03
Further Details:      
 
Weak hits

Sequence:  gi|76803181|ref|YP_331276.1|
Domain Number - Region: 558-599
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0415
Family Phage repressors 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76803181|ref|YP_331276.1|
Sequence length 1037
Comment ATP-dependent DNA helicase (intein-containing) [Natronomonas pharaonis DSM 2160]
Sequence
MARAEDTEIIDKFEQFYRDYYRDEIGQLAQKYPEDQRSLYIDWDDLYRFDADLADDLVAQ
PDQIRDYAEEALRLYDLPVDVQLGRAHVRVHNLQQTTGIRDIRARHRGNLVEVTGIVRKA
TDVRPKITEAAFECQRCGTLTRIPQTAGDFHDPHECQGCERQGPFDINFDQSEFVDAQKI
RVQESPEGLRGGETPQSIDVHIEDDITGKVTAGDHVRVAGVLHLDQQGSEQEKSPVFDVY
MDGMSVEIEDEQFEDMDITDEDKQRIIELSNDDGIYQQMVESMAPSIYGYEQQKLAIIMQ
LFSGVTKDLPDGSRIRGDLHMLLIGDPGTGKCVDGDTSVTLASGDEKPIRDIVESTLEDP
TEISDGFYQESDIDVLTTDGGAVAPGRATKVWKRQAPEKMYRIRTESGRELEVTPSHPLF
VQSEGGLSPLVADDLSENDFVAVPRALPADDGDDFGQHVDDLGSVTARKTADAEAVRSED
AATTPDVIPNVGDQLRRIRTSLRLSQHDCGLPRSTYQQYERGDRNPSRSRLQTVLTAFER
RIEQLSSLSDRVDDGDSDAIAAARDELNPSQASLASGMDATRTAIGDDERTEARPDGGAV
ADAERAVADALCRALAVADDVERLRSLADGDIGWDRIDSIEPVEPEDEWVYDLEVESTHS
YLSNDVVSHNSQLLQYVKNIAPRSVYTSGKGSSSAGLTAAAVRDDFGEGQQWTLEAGALV
LADQGIAAVDELDKMRSEDQSAMHQALEQQEISVSKAGINATLKSRCSLLAAANPIHGRF
DEYEPFAEQIDLDPPLISRFDLIFTVTDQPDEEEDRQLAEHIIETNYAGELQTHRTKAAT
SNVSQEQVDSVTEDVAPAIDDELLRKYVAYAKRNCYPTMTEEAKEAIQEFYVDLRLEGQS
EDNPVPITARKLEALVRLAEASARIRLSDTATKDDAERVIEIVRSSLEDVGVDPETGELD
ADIIESGTSKTQRDRIKNIKSLISEVETEYDEGAPIDVVLDRAEEMGMDRSQAEHEIEKL
RRQGDVYEPQTDHLRTV
Download sequence
Identical sequences A0A1U7EZB2
gi|76803181|ref|YP_331276.1| 348780.NP5106A WP_011324254.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]