SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803186|ref|YP_331281.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803186|ref|YP_331281.1|
Domain Number 1 Region: 2-255
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.38e-48
Family LplA-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76803186|ref|YP_331281.1|
Sequence length 260
Comment lipoate-protein ligase 1 [Natronomonas pharaonis DSM 2160]
Sequence
MDWRLITEERLDGPTAMAYDEVAAETVAEGGPATVRLYRWTPSTVSLGYANDADIIDWEF
CAANGIDVTRRATGGGAIYHDGVGEVAYSIIAPKADLPGDVTASYRQLLQPVLSAFEAAG
AEVRFAPEPSEPLWQPMCYLRGLDPAHDLVGPDGRKVAGNAQHRTREAVVQHGSLTVAAK
PQRHIGCFADPPVDPADFESTVTGIDVDRAALVEKLEASLAAWADADDGGWTSVERERAA
ELVDVKYDNDSWVRDRGDPT
Download sequence
Identical sequences Q3IMK9
WP_011324259.1.57290 348780.NP5116A gi|76803186|ref|YP_331281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]