SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803191|ref|YP_331286.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803191|ref|YP_331286.1|
Domain Number 1 Region: 14-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-47
Family Nitrogenase iron protein-like 0.085
Further Details:      
 
Domain Number 2 Region: 276-450
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 6.42e-27
Family Class I glutamine amidotransferases (GAT) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76803191|ref|YP_331286.1|
Sequence length 511
Comment cobyric acid synthase [Natronomonas pharaonis DSM 2160]
Sequence
MPPPRRYAVSRARTVLVAGTASHVGKSTVAAGLCRLLSDSGVSVAPFKAQNMSNNARAVA
AATGSGFGEIGVSQYVQARAAGVAATTDHNPVLLKPRGSGESQLVIDGAAAGNFAAGEYY
ETGWERARAAAERAHERLASDHDVIVAEGAGSIAEINLQDRDLANIETARFADADIVLVA
DIERGGVFAAIVGTVELLPEDIRERVAGVVITKFRGDVSLLEPGLETLEAKTGVPVLGVL
PYDDPGLPEEDSVSLPAADESATLGDDDGVADGRTVTVAVPRFPRASNVTDIEPLARVPG
VRVRFVPLDAPLSADAVVLTGTKNTVDDALAAREAGLYDRLRAFDGPVVGICGGYQLLGE
RLLDADIEGTGDTETVPGVGLLPVETRFHPEKTVEPVTRTLDGCGPLAGASGPVSGYEIH
MGQSRLLSPVDRPFEERGAATDAVLGVYLHGLFENRLARAAFVRAVYASAGRSRPEADTP
DRSPYDRAAALVSELDLAPLGLAAESLSSDD
Download sequence
Identical sequences 348780.NP5126A gi|76803191|ref|YP_331286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]