SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803245|ref|YP_331340.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803245|ref|YP_331340.1|
Domain Number 1 Region: 1-42
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.0000000000000654
Family RBP12 subunit of RNA polymerase II 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76803245|ref|YP_331340.1|
Sequence length 44
Comment DNA-directed RNA polymerase subunit P [Natronomonas pharaonis DSM 2160]
Sequence
MSYKCSRCKRDVELDEYGGVRCPYCGHRVLLKERSRDIKEVEVE
Download sequence
Identical sequences Q3IMF0
WP_011324318.1.57290 gi|76803245|ref|YP_331340.1| 348780.NP5234A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]