SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803283|ref|YP_331378.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803283|ref|YP_331378.1|
Domain Number 1 Region: 193-345
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.7e-16
Family MoCo biosynthesis proteins 0.038
Further Details:      
 
Domain Number 2 Region: 514-560
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000445
Family ComEA-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76803283|ref|YP_331378.1|
Sequence length 572
Comment Fe-S oxidoreductase [Natronomonas pharaonis DSM 2160]
Sequence
MQDPADLDVTIVDGYVDEPAHFGVPPYISTYPRFAAGAAVDAGVDPDSITYHTIDELRES
RRLWEDVADADLFVYVGGMTVPGKYVGGTPAEPDEVRKLAWTAEGVSVMGGPVRFGVGEA
NEGATETKRQNLDYDFLALADIEAAVYDLLHGGLEGFEDRYRDNEELDRWARKGAFIVEQ
HPDHPDYLICELETSRGCPYRCSFCTEPMYGDPTFRTPDSVVSEVGGLADHGVRHFRLGR
QADILAYGGDGEAPNPDALRELYGGIRDVVPDLGTLHLDNMNPVTITDYPEKSREGIRVI
AEHNTPGDTAAFGLESADPVVREKNNLLVSAEECLEAVRIVNEAGGWRPGEAPGSGPSVD
ANADRLPKLLPGINLVHGLEGERAETFEHNKQFLQDVYDEGLMLRRINIRQVMAFEGTEM
AETGADIAHDHKQQFKTYKQAVREEIDNPMLQRVAPPGTVLPNVYLEYHEDGRTFGRQLG
TYALLVALPGERELGRTVDVAVTDHGYRSVSGVPYPLDINAASMDELRALPGIGKQRAGN
LFVDRPHETVPNLDDGPDLGTFCVTGGSGSAD
Download sequence
Identical sequences A0A1U7EZK9
348780.NP5312A WP_011324356.1.57290 gi|76803283|ref|YP_331378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]