SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803414|ref|YP_327683.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803414|ref|YP_327683.1|
Domain Number 1 Region: 9-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000332
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 166-238
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.00000000000353
Family TrkA C-terminal domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76803414|ref|YP_327683.1|
Sequence length 257
Comment transcriptional regulator [Natronomonas pharaonis DSM 2160]
Sequence
MSDTGSEHRLDQIDRRIIYALMGDARNTSAPDIAEHLSVSGATVRNRIARLEERGIIKDY
QATIDFEQADGSLMNLYLCHAPFGEVEAVSRKLGTVPGVINVRELMGGRRNLHVLAVGRD
TDDLRRIGREIEELDIEIEDEFLLQQELHFPYLPYGPEESRPGKPLADYMSLAGGAEVVE
LTVEESAPIVGCTLEEATQKNIIEEQTLVIAIERDDTVITPKGDTEIQPQDVVTVFSPGG
AGELVAEGFRSPPDHEA
Download sequence
Identical sequences Q3IM32
348780.NP6106A gi|76803414|ref|YP_327683.1| gi|76803414|ref|YP_327683.1|NC_007427 WP_011324435.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]