SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803438|ref|YP_327707.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803438|ref|YP_327707.1|
Domain Number 1 Region: 33-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000251
Family Vacuolar sorting protein domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76803438|ref|YP_327707.1|
Sequence length 193
Comment hypothetical protein NP6160A [Natronomonas pharaonis DSM 2160]
Sequence
MTSTYIKTKPERCCMTEDESDSEGLMERQTTGEDRVRMVARQLSEPQTANWIASEAGWSH
EPTKRVLERLVDDGILHCDESGTHTTYYPDYRRQAMQEAMRLRDSGHTVEELTDRLADMK
TQIRDWEDEFGVESPNQLRGTLADESLDGGEEDRRRDIAREWEHLQRRIQIVGFAIREWD
FLAPTTEPAEASS
Download sequence
Identical sequences Q3IM08
gi|76803438|ref|YP_327707.1| WP_011324459.1.57290 gi|76803438|ref|YP_327707.1|NC_007427 348780.NP6160A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]