SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803445|ref|YP_327714.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803445|ref|YP_327714.1|
Domain Number 1 Region: 85-255
Classification Level Classification E-value
Superfamily GAF domain-like 1.57e-42
Family IclR ligand-binding domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 17-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000342
Family Transcriptional regulator IclR, N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76803445|ref|YP_327714.1|
Sequence length 256
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MVSEPDNDGGIKSAGTSFGIIETIYQNQPISLTELAAEVDIANSTAYEHISTLLDSGYIV
KRADGYYLSLKFLDRGTKAKEYYQELLDVSEPALEQLVDETDEAVNLVVEEHGQAVYIDR
RTGERGVPTNSWVGKRKPLHTLSAGKAILSQLPEERVDEILDARGLSVSTERAITTREEL
YDELEEIRQNGVSFNDRESHSQIRAVGAPIVVDDRVYGAVSVAGPAMRLTGEYFRQEIAD
LLQGAVNEIELKLTYH
Download sequence
Identical sequences Q3IM01
WP_011324466.1.57290 gi|76803445|ref|YP_327714.1|NC_007427 348780.NP6176A gi|76803445|ref|YP_327714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]