SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803457|ref|YP_327726.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803457|ref|YP_327726.1|
Domain Number 1 Region: 5-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000248
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.036
Further Details:      
 
Domain Number 2 Region: 73-148
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.000000000282
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76803457|ref|YP_327726.1|
Sequence length 165
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MTGELDERDFRILCAIAEHETFSSEDLHEETGIPKSTVHYRIQNMKDEGVIKNELFEFDR
EKIGIEITLISEVWAEFGEGYHDTVGEKLSEIEGVNQVYFTMGDTDFVAIARLTSRDMVE
QLVEDYESIDEIQRTSSKFAISTIKEDISISALGDYSVETLLDSD
Download sequence
Identical sequences Q3ILY9
gi|76803457|ref|YP_327726.1| WP_011324478.1.57290 348780.NP6200A gi|76803457|ref|YP_327726.1|NC_007427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]