SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803467|ref|YP_327736.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|76803467|ref|YP_327736.1|
Domain Number - Region: 152-194
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0269
Family Heat-inducible transcription repressor HrcA, N-terminal domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76803467|ref|YP_327736.1|
Sequence length 203
Comment DNA binding protein [Natronomonas pharaonis DSM 2160]
Sequence
MDGMFTATVHFTQHRECILRELTADVERPVPIEIEELQNGVVTFVLQAGSHADAFQTELE
AADHVKHVKRLNEENLLVTKPSCGAYSAIYQNHGTLQRSNIVNGRQREYNILVFQRSDLK
DIIADLREFGTVTLGRLEEFKTTDSPLTARQQEVVSEALTRGYYEWPREITSEELAAELD
ISRATLHEHLRKAEQTLLSSEVG
Download sequence
Identical sequences Q3ILX9
gi|76803467|ref|YP_327736.1| gi|76803467|ref|YP_327736.1|NC_007427 348780.NP6220A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]