SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800857|ref|YP_325865.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800857|ref|YP_325865.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Translation initiation factor 2 beta, aIF2beta, N-terminal domain 9.16e-18
Family Translation initiation factor 2 beta, aIF2beta, N-terminal domain 0.00085
Further Details:      
 
Domain Number 2 Region: 142-201
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000411
Family TRAM domain 0.0041
Further Details:      
 
Domain Number 3 Region: 98-132
Classification Level Classification E-value
Superfamily Zinc-binding domain of translation initiation factor 2 beta 0.000000000445
Family Zinc-binding domain of translation initiation factor 2 beta 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76800857|ref|YP_325865.1|
Sequence length 203
Comment translation initiation factor IF-2 subunit beta [Natronomonas pharaonis DSM 2160]
Sequence
MEYEASLDRALADVPDIASSGERLSVPDAAAQTDGAFTRFTNLSAVADALNRDADHIHRF
VQQTLATSGKLSEGVGRYNGDFDDRDFEAAVDDYADEYVRCSECGLPDTRLVQEDQTLML
RCDACGAFRPVSKNTGSSSTQTQDDDVEAGNTYTVKVTDTGRKGDGVAHRGDYTIFVPGA
SEGDVVDVYIENTSGTLAFSRIA
Download sequence
Identical sequences A0A1U7ETP6
348780.NP0406A WP_011321932.1.57290 gi|76800857|ref|YP_325865.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]