SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800946|ref|YP_325954.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800946|ref|YP_325954.1|
Domain Number 1 Region: 13-279
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-40
Family Extended AAA-ATPase domain 0.00038
Further Details:      
 
Domain Number 2 Region: 288-372
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-20
Family Helicase DNA-binding domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76800946|ref|YP_325954.1|
Sequence length 374
Comment cell division control protein 6 [Natronomonas pharaonis DSM 2160]
Sequence
MADDDMLSWDESVFRDEGVLELDYLPEAFLHRDEQMETLKYALRPAVRGSRPLNVMARGP
PGTGKTTAVQKLFDELAGVGGVETVRVNCQVDSTRYAVFSRLFESLFEYEPPASGVSFNK
LFGQITNRLVEDDDVLVVALDDVNYLFYESEASDTLYSLLRAHESHSGAKIGVIVVSSDL
DLNVIEELDGRVQSVFRPEDVYFSAYGERAIADILSERVERGFREGAVSARVLDRVAEHT
ADSGGDLRVGIDLLRRAGLNAEFRGSTEVAVADVDTAYEKAKYIHLSRRLQGLSESEAAL
VRVLTDHDGERAGAVYEAFSEETELGYTRYSEIVNKLEQVGVVDAEYTNVDGRGRSRELS
LAYDADAVLERLEE
Download sequence
Identical sequences A0A1U7ETW8
gi|76800946|ref|YP_325954.1| 348780.NP0588A WP_011322021.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]