SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76800950|ref|YP_325958.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800950|ref|YP_325958.1|
Domain Number 1 Region: 125-219,274-446
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-51
Family Extended AAA-ATPase domain 0.00093
Further Details:      
 
Domain Number 2 Region: 451-557
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-30
Family Helicase DNA-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76800950|ref|YP_325958.1|
Sequence length 571
Comment cell division control protein cdc6-like protein [Natronomonas pharaonis DSM 2160]
Sequence
MTNDDTASEPRTQDRLERGSGDTDEDSEDTVDIDTDTEGSDDVATPSQSSGSPVETGGFS
EDESDSERTDSVPTGSEHARNVDGFSGDIDLEDLDLAPDDETEEDGEADEASRGLFDDLL
EGEPIFENKEVLRPSYTPHKLPHREEQINNMATILVTALRGETPSNILIYGKTGTGKTAS
AKFVSEELETTSQKYEVPCEVQYINCEVTDTQYRVLAQLANKFIEKNEAYIESRLDELEA
LRDRAAEDPAALDDTEFDSVAAVEAEIDTLETDLEEFDPVPMTGWPTDRVYSTFFDAVDY
HERVVVIMLDEIDKLVEKSGDDTLYNLSRMNSELSNSRVSIMGISNDLKFTDFLDPRVKS
SLGEEEIVFPPYDATQLRDILQHRAEIAFKPDTLSDDVIPLCAAFAAQEHGDARRALDLL
RTAGELAERDRTETITEKHVRKAQEKIELDRVVEVVRTLPTQSKLVLYATILLEKNGVHN
INTGEVFNIYKRLCEEIDADVLTQRRVTDLISELDMLGIVNAVVVSKGRYGRTKEISLSV
PLDETEAVLLSDSRVGEVEDAQPFVQARFDN
Download sequence
Identical sequences A0A1U7ETY0
gi|76800950|ref|YP_325958.1| 348780.NP0596A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]