SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801093|ref|YP_326101.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801093|ref|YP_326101.1|
Domain Number 1 Region: 23-340
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 3.52e-106
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000289
Further Details:      
 
Domain Number 2 Region: 425-602
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.5e-53
Family NAD+-dependent DNA ligase, domain 3 0.0000999
Further Details:      
 
Domain Number 3 Region: 343-421
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.02e-24
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00053
Further Details:      
 
Domain Number 4 Region: 610-685
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000748
Family DNA ligase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76801093|ref|YP_326101.1|
Sequence length 691
Comment NAD-dependent DNA ligase LigA [Natronomonas pharaonis DSM 2160]
Sequence
MEEPEDNPYIRDPPLDFEPVDELDAASATRQVETLREAIRFHDYRYYQLADPVISDRAYD
QLFERLERLESKFDRSSATSPTQRVGGEPLDELETVEHVAPMRSIESSVEVDDIRDFDTR
IQERLAAAGYEGPVRYLCEPKFDGLSVELVYEEGELSRAATRGDGQEGDDVTANVRTIRS
VPLTLDGDCPSFLAVRGEIFMPKDAFQEYNRERLERGEEPFSNPRNAAAGTLRQLDPSVT
AERPLDCFVFDILDDGGRGFETRMAEHEAVESWGFQVDDHTARVDDIEAAIAFREEMLDG
RASLDYEIDGIVIKLDRKDACALLGATARAPRWAYAYKFPARTEETTVRDIVLQVGRTGR
LTPVALLDPVEVSGVEVSRATLHNPQQIAELGVGIGDRVTLKRAGDVIPYIEAVVDSERE
AHFEFPDRCPVCESPLERDGPLAYCTGGVACPAQLRRAVEHYASRSGLDIEGLGESAVDQ
LVDAGLVERLPDLYDLSVADVAELDGWGRTSAENLLEELEASTEPPLPAFLSALGIPGVG
TTTAADIAREFGTLDAVMDATAEELRAVDGIGPTLGGEIAEFFDSDRNQQVIEQLRKRGV
DPEPAETAGDALSGQTFVFTGSLDGLTREEAHELVETSGGTATGSVSGNTDYLVVGDSPG
QRKREAANEHGVETLSQSDFESLLESHGIEI
Download sequence
Identical sequences Q3ITK1
gi|76801093|ref|YP_326101.1| WP_011322168.1.57290 348780.NP0882A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]